Pancreatic Polypeptide (human) trifluoroacetate salt，CAS:75976-10-2

H-Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH₂ trifluoroacetate salt

Product description

As antagonist of CCK, PP inhibits pancreatic sedretion. PP also acts on the gastrointestinal motility, food intake, and metabolism.

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	75976-10-2
Sequence	APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH₂
Molecular Formula	C₁₈₅H₂₈₇N₅₃O₅₄S₂
Storage	-20℃,protected from light and moisture
Transportation	4-25℃ temperature for up to 2 weeks
Stability	1 year

Document

msds of Pancreatic Polypeptide (human) trifluoroacetate salt

Related Product

• biotinyl-pancreatic-polypeptide-human-trifluoroacetate-salt